Domain assignment for gi|389863138|ref|YP_006365378.1| from Modestobacter marinus

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
8 262 ClpP/crotonase 2.96e-76 Crotonase-like 0.0000358 1uiy A: Alignments

Protein Sequence Details

Sequence length 262
Comment carnitinyl-CoA dehydratase [Modestobacter marinus]
Sequence
MAQRSGSGLVTETRGHVRLLTLDRPERRNALSSALQADLVAELLDCAADGEVRAVVLTGNGPAFCAGFDLKEIRELDERGESFRPPMDRPGRSLFEVLSETYVPVVAALTGHAVAGGFELALACDIRIAAPGIRLGLPEATIGMGANYGSVVLSKRIPTGIALEMLFTGDPVSSEEAARWGLVNRVVPAEEVLPEALRLAERIAANAPLSVRRMKETAVKGLDLPLATALRLDVGPNPYLSEDRKEGIAARLEKRAPRWSGR

Download

Sequence (FASTA)