Domain assignment for gi|389862967|ref|YP_006365207.1| from Modestobacter marinus

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
2 253 ClpP/crotonase 1.71e-77 Crotonase-like 0.0000376 2dub A: Alignments

Protein Sequence Details

Sequence length 254
Comment carnitinyl-CoA dehydratase [Modestobacter marinus]
Sequence
MTGPVLTEVADGVGVLTLNRPEAKNAVDLATTEALAAALDEFDARDDVAVLVLTGAGGTFCAGMDLKAFARGERPRIEGRGFAGLTEAPPAKPLIAAVEGWALAGGCELALSADLVVAARDARFGIPEVKRGLFAAGGGVLRLAKALPYQRAMEMALTGDPLPAEEAHRFGLVNVLTEPGGALAGARELAARITVNGPLAVRASKQLVAGSVGWTDRAALDAQQELADRVFASADALEGARAFAEKRAPVWRGV

Download

Sequence (FASTA)