Domain assignment for gi|389862967|ref|YP_006365207.1| from Modestobacter marinus

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

	Start Residue	End Residue	Superfamily	Superfamily E-value	Family	Family E-value	Closest structure	View
	2	253	ClpP/crotonase	1.71e-77	Crotonase-like	0.0000376	2dub A:	Alignments

Protein Sequence Details

Sequence length	254
Comment	carnitinyl-CoA dehydratase [Modestobacter marinus]
Sequence	MTGPVLTEVADGVGVLTLNRPEAKNAVDLATTEALAAALDEFDARDDVAVLVLTGAGGTFCAGMDLKAFARGERPRIEGRGFAGLTEAPPAKPLIAAVEGWALAGGCELALSADLVVAARDARFGIPEVKRGLFAAGGGVLRLAKALPYQRAMEMALTGDPLPAEEAHRFGLVNVLTEPGGALAGARELAARITVNGPLAVRASKQLVAGSVGWTDRAALDAQQELADRVFASADALEGARAFAEKRAPVWRGV

Download

Sequence (FASTA)

---