Domain assignment for gi|389862884|ref|YP_006365124.1| from Modestobacter marinus

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
7 358 Nucleotide-diphospho-sugar transferases 2.93e-70 glucose-1-phosphate thymidylyltransferase 0.00000871 1yp2 A:10-316 Alignments
299 397 Trimeric LpxA-like enzymes 1.83e-18 GlmU C-terminal domain-like 0.013 1yp2 A:317-451 Alignments

Protein Sequence Details

Sequence length 405
Comment glucose-1-phosphate adenylyltransferase [Modestobacter marinus]
Sequence
MRGGPRVLGIVLAGGEGKRLAPLSQDRAKPAVPFGGNYRLIDFVLSNLVNADIRRIAVLTQYKSHSLDRHITTVWRMSTLLGSYITPVPAQQRLGPRWYTGSADAIYQSLNLIYDDRPEIVVVFGADHVYRMDPAQMIEQHLATGAGVTVAGLRVPRKEATAFGVIDSDASGKVLQFLEKPEDPPGLPDNPDETFASMGNYVFTTDALLEALRVDAADDNSVHDMGGSIMPMMAGAGDAYVYDFSNNQVPGETERDHGYWRDVGTLDAYYDAHMDLVSVSPIFNLYNDRWPIYTLPPMLPPAKFVLGGRAEESMVSAGVIIDGGSVHGSVVSPNVRLERGSRVEGSVLMDGVHIGEGAIVRRAILDKNVVVPPGAHIGVDLERDRERYQVSAGGVTVLGKGARAI

Download

Sequence (FASTA)