Domain assignment for gi|389862784|ref|YP_006365024.1| from Modestobacter marinus

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
4 235 ClpP/crotonase 1.42e-42 Crotonase-like 0.0000912 1uiy A: Alignments

Protein Sequence Details

Sequence length 242
Comment enoyl-CoA hydratase/isomerase [Modestobacter marinus]
Sequence
MLITEERDDGAVLRIEHGRVGALDVELLDALTEAVSASDRALVITGTGSSFSAGVDLRRILEGRRPYTEALLTALSRTYRAVFDHPRPTVAAVNGHAIAGGCVLALACDLRLMSGGRIGLTELAVGVPFPTTALEVVQHALGPRTGRVLLGGQLEDREHALALGMVDELTEPGELVPRAVALAAELAARSPEAYRLAKVQLHRQANAAIEATAGGDAAVLAGWASDDTRLRIEAALAALSRR

Download

Sequence (FASTA)