Domain assignment for gi|389862642|ref|YP_006364882.1| from Modestobacter marinus

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
5 258 ClpP/crotonase 3.06e-63 Crotonase-like 0.00015 1nzy A: Alignments

Protein Sequence Details

Sequence length 260
Comment enoyl-CoA hydratase/isomerase [Modestobacter marinus]
Sequence
MSGPVTTALDGDVWHVTLDDAARGNVVDQAMAEQLRAALEQRPGTARAVLLTAAGPRFCVGGDVRVFADAAEDMPEVVGRLAHTWHDTIRAVLYCDVPVVAGVHGAVAGAGLGLLGACDIVVCARGTKLRPAYGGLGLSPDGGTSWALTRALGAPRALELMLTDGTLSAADAHLFGLVARLVDDDELLDVATALASQVAAGPVRSMVRTRGLVRRAAVRTLEEQLVDEERLIRESAADPESREGVAAFLARRPPDFPGAG

Download

Sequence (FASTA)