Domain assignment for gi|389862589|ref|YP_006364829.1| from Modestobacter marinus

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
5 339 Nucleotide-diphospho-sugar transferases 1.85e-67 glucose-1-phosphate thymidylyltransferase 0.00012 1yp2 A:10-316 Alignments
234 378 Trimeric LpxA-like enzymes 9.06e-19 gamma-carbonic anhydrase-like 0.056 1v3w A: Alignments

Protein Sequence Details

Sequence length 393
Comment glucose-1-phosphate adenylyltransferase [Modestobacter marinus]
Sequence
MALPKVLVLVLAGGKGSRLELLTETRAKPAVPFAGVYRLIDFPLSNCEHSGIADVWVSVQYQPQSVNEHLANGRPWDLDRTTGGLMMLTPFQGSERGGWTEGTADGLWRQSELIRQFDPDALVVVSSDAVYKLDYREVVDAHLASGAEVTMVTTEVDADDASRYGIVVVGDDGQVTDYAYKPDEPASTTATNEVFVFSPTATLDRLQALKDQVGDDGLEDLGNHLLPAQTKDGLARAYRLEGYWRDVGTVESYWQAHRDFLSADPPIDLDELDWPIHTRGGRHSAARVLDDGQIENSLLSGGTRVSGNVRGSVLSPGVVVEAGATVQDSVLLPGVHVRAGATVTRAVLDDNVVVGAGATVGGDGDITLVGREATVPDGGQVPAGGRLPEPERD

Download

Sequence (FASTA)