Domain assignment for gi|389862107|ref|YP_006364347.1| from Modestobacter marinus

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
26 293 ClpP/crotonase 3.53e-70 Crotonase-like 0.00000000378 1q52 A: Alignments

Protein Sequence Details

Sequence length 296
Comment Naphthoate synthase [Modestobacter marinus]
Sequence
MSARADVSEIFDASAWEPVAGFDGLTDVTYHRAVDAGVVRIALDRPEVRNAFRPQTVDQLLAVFEHARLSTDVGCVLLTGNGPSEKDGGWAFCSGGDQRVRGRYGYEAGDGANGRLHILEVQRLIRFMPKVVVCVVPGWAAGGGHSLHVVADLTLASAEHARFKQTDADVGSFDGGFGSAYLARQVGQKFAREIFFLGEEYSAEDAHRMGMVNRVVPHAELEATALDWGRRIVAKSPTAQRMLKYSFNLIDDGLVGQQLFAGETTRLAYMAEEAVEGRDSFLEKRPADFSRFPWHA

Download

Sequence (FASTA)