Domain assignment for 2013570613 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 182 Thiolase-like 2.58e-44 Thiolase-related 0.00011 1qfl A:4-268 Alignments
159 234 Thiolase-like 2.97e-17 Thiolase-related 0.0028 1qfl A:269-392 Alignments

Protein Sequence Details

Sequence length 234
Comment YNP6_558250 Acetyl-CoA acetyltransferase [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
MDAIVQAWRHIQVGDGEIYLVGGVESMSNIPYIIKGARWGLKLRHSELTDAMWEGLTDPICNQLMGRTGENLADEFEVTRQQQDEYAVQSHKKAFMAQRMGKFADEIVPVEVVKKAAGQEVAKEKIIQDETINPGLTVQKAALYPTIFKRDGGTVTPANSCGISDGASAVLIMTAEKAKELGYTPLARIVSYGYAGVEPHRMGIAPASAVPKALEKAGLKLEQIDLIEINEAFA

Download

Sequence (FASTA)