Domain assignment for 2013570083 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
41 168 Thiolase-like 9.54e-30 Thiolase-related 0.01 1afw A:294-417 Alignments

Protein Sequence Details

Sequence length 181
Comment YNP6_552930 Acetyl-CoA acetyltransferase [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
LDSSPIADGAACVILAPTAIAKEFTRKPIRVKATAIATDTLAVHDRRDPLYLEGGAISAQKAYAMAGVGPADIDLFEVHDAFTIMSALSLEAAGFAPRGQGVRLAMEGEIGLGGRIPITTMGGLKARGHPVGATGMYQIVEVAEQLREEAGANQVKNARLGMAQNIGGSGATVVTTILERT

Download

Sequence (FASTA)