Domain assignment for 2013569686 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
3 203 Thiolase-like 5.76e-66 Thiolase-related 0.00017 1j3n A:250-408 Alignments

Protein Sequence Details

Sequence length 236
Comment YNP6_548950 Polyketide synthase modules and related proteins [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
RCSSDGMMLGEGIGIVVLKRLEDAVRDNDKIYAVIKGIGTSSDGRYKSIYAPRQEGQVQALRRAYEDAGFPPETVGLIEAHGTGTMAGDPTEFSSLREFFTENNSKRHHIALGTVKSQIGHTKAAAGAASLIKTALALHHKILPATINVTEPNPKLNIKNSPFYLNTETRPWIRSEGEAPRRAGVSSFGFGGTNYHVVLEEYEGEHNQAYRLHAAPSEIVLFAQTPAELLSSCQKL

Download

Sequence (FASTA)