Domain assignment for 2013569181 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 126 Thiolase-like 1.15e-37 Thiolase-related 0.0001 1wdk C:264-391 Alignments

Protein Sequence Details

Sequence length 128
Comment YNP6_543880 3-ketoacyl-CoA thiolase (EC 2.3.1.16) [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
GCDPAQMGLGPVYAATPILKRHGLSLQDFDTIEINEAFAAQVLACLRAWQDADFCRQELGLEGALGAVDHERLNVNGGAIALGHPVGASGARIVLTALNTLKRTGGKRALAAICIGGGQGGAMLLEAA

Download

Sequence (FASTA)