Domain assignment for 2013568914 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 74 Thiolase-like 2.4e-21 Thiolase-related 0.00037 1qfl A:269-392 Alignments

Protein Sequence Details

Sequence length 79
Comment YNP6_541200 acetyl-CoA acetyltransferase (EC 2.3.1.9) [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
VLAVARVLGWDWNKVNVNGGAIALGHPVGSSGCRIVVTLLHEMKRRNKEGKTPVKYGLATLCAAGGQGSALIIEALNGA

Download

Sequence (FASTA)