Domain assignment for 2013568202 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
100 221 Thiolase-like 6.72e-38 Thiolase-related 0.00015 1wdk C:264-391 Alignments
1 99 Thiolase-like 4.4e-26 Thiolase-related 0.0002 1qfl A:4-268 Alignments

Protein Sequence Details

Sequence length 223
Comment YNP6_534030 Acetyl-CoA acetyltransferase [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
ISRQEQDEYAIQSYTRSAEAWKAGYFKNEVVPLQVNGKKGPVMVEEDEEYKNVSFEKIPLLKPAFEKDGTITAANASTINDGASAVILMSGEEVKRRGLKPLAKIISYADAEQEPVWFTTTPKAAMEKALKKANLSLDKIDFVEINEAFSVVAIANAKLMNIPYSKLNVFGGAVSLGHPLGSSGCRIVVTLLNVLRTKGGKYGMAGICNGGGGATALIVENLQ

Download

Sequence (FASTA)