Domain assignment for 2013567523 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
2 59 Cytidine deaminase-like 0.000000000000013 Deoxycytidylate deaminase-like 0.024 1vq2 A: Alignments

Protein Sequence Details

Sequence length 60
Comment YNP6_527240 Deoxycytidylate deaminase [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
MHVGCVLVKDKFVLATGYNGSLPGLPHCDDVGCLIVDNHCVRTNHAEINALTQAATHGVN

Download

Sequence (FASTA)