Domain assignment for 2013567346 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
10 194 Thiolase-like 1.58e-40 Thiolase-related 0.0000677 1j3n A:1-249 Alignments

Protein Sequence Details

Sequence length 197
Comment YNP6_525470 3-oxoacyl-(acyl-carrier-protein) synthase [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
NPFIPESMRKSLKVMSRAARFGVGAAGLALADSGISIENENPERVGVVVGTGLTPIDMPEIMPVLQKVMLPDGQFDLTPLGANAENPLFPLWLLKYLPNMPSAHISMMFNAQGPNNTVTTACVAGTQAIGEAFRMIARDEADVMIAGGTDSRLDPLLLMAYTSMGTLSRRMDLPPHEVSRPFDRTRDGFVLGEGLEC

Download

Sequence (FASTA)