Domain assignment for 2013567217 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
3 46 Thiolase-like 0.0000000504 Thiolase-related 0.016 1qfl A:4-268 Alignments

Protein Sequence Details

Sequence length 47
Comment YNP6_524170 acetyl-CoA acetyltransferase (EC 2.3.1.9) [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
MKEVFIVAAGRSPIGSMSGALSALSVTQLGAQVTQKLLANAGIAPSI

Download

Sequence (FASTA)