Domain assignment for 2013565377 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 180 Thiamin diphosphate-binding fold (THDP-binding) 9.26e-63 Pyruvate oxidase and decarboxylase Pyr module 0.00000298 1ybh A:86-280 Alignments
155 219 DHS-like NAD/FAD-binding domain 0.000000327 Pyruvate oxidase and decarboxylase, middle domain 0.032 2dji A:187-363 Alignments

Protein Sequence Details

Sequence length 236
Comment YNP6_505700 Thiamine pyrophosphate-requiring enzymes [acetolactate synthase, pyruvate dehydrogenase (cytochrome), glyoxylate carboligase, phosphonopyruvate decarboxylase] [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
MKLTGAEIVWECLVREGVNVIFGYPGGAILPTYDAMTKYPQIHHVLVRHEQGATHMADGYARASGRVGTAIATSGPGATNMVTGIANAMMDSSPIVCITGQVGSKAIGSDAFQETDVTGVTLPITKHNYLVTRPEDIARTLREAYYIARSGRPGPVLVDITKDAQQLTADFDWEAAAPRLPGYRPNLRALPSEYQRAIELINSARRPLILAGQGVIKSRRDAPRARPGREGRRSPS

Download

Sequence (FASTA)