Domain assignment for 2013564871 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
2 90 Thiolase-like 1.92e-32 Thiolase-related 0.00039 1qfl A:269-392 Alignments

Protein Sequence Details

Sequence length 91
Comment YNP6_500620 Acetyl-CoA acetyltransferase [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
KNGMQANDVDLYEVNEAFAVVPLYFMDMLGVAHDKVNVNGGAIAMGHPLGATGAIILGTLLDELERQNKQTGIATLCVGGGMGIATLIERV

Download

Sequence (FASTA)