Domain assignment for 2013564619 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
63 220 Dihydrofolate reductase-like 4.32e-35 RibD C-terminal domain-like 0.00078 2hxv A:148-345 Alignments
3 59 Cytidine deaminase-like 0.0000692 Deoxycytidylate deaminase-like 0.0052 2b3z A:1-145 Alignments

Protein Sequence Details

Sequence length 220
Comment YNP6_498060 Pyrimidine reductase, riboflavin biosynthesis [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
VELIKKHRFRRVVIACTDVNPLVAGKSIAALASAGVDLKVGVLEQKGRYLIRFFDTFFTKKRPYVRLKWAQSADGFIGKRTERVWLSNEISKKFAHKLRYETAAIMIGGTTAQIDRPRLDNRLWYGGSPIKIILDRQGKTAADSSHPLNSGERAPIFVTEASENVTPHQEIITIKFDEDLARHVLDKLYQRKINSLLVEGGAKLLQTFIDANYWDEAYIF

Download

Sequence (FASTA)