Domain assignment for 2013564398 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 126 Thiolase-like 5.76e-49 Thiolase-related 0.0000142 1e5m A:256-416 Alignments

Protein Sequence Details

Sequence length 128
Comment YNP6_495840 3-oxoacyl-[acyl-carrier-protein] synthase II (EC 2.3.1.41) [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
AMRRADVTPEDIDYINAHGTATPLNDIAETQAVKRVFGDRAYKVPMSSTKSMTGHMMGATGALEAAVCIYAIQHGVIPPTRNLTEPDPQCDLDYVPGEARPHRVNVAMNNSFGFGGHNSVLIFKRYDG

Download

Sequence (FASTA)