Domain assignment for 2013563210 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
92 213 Thiolase-like 1.49e-40 Thiolase-related 0.0001 1afw A:294-417 Alignments
1 91 Thiolase-like 2.41e-16 Thiolase-related 0.0016 1qfl A:4-268 Alignments

Protein Sequence Details

Sequence length 214
Comment YNP6_483920 Acetyl-CoA acetyltransferase [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
AQAAGRFDEEIVPVTATMKLVNRETGQVSERTVTLTKDEGNRPETTLEALRGLQPVRGPGKTITAGNASQLSDGASAAVLMEAKEAARRNLEPLGRYCGMAVAGLAPDEMGIGPIHAVPKLLKQHGLKVDDIGLFELNEAFAVQVLHCADVLGLPIERLNVNGGAISIGHPFGMSGARLVGHALLEGRRRGVRHVVVTMCVGGGMGAAGLFEVL

Download

Sequence (FASTA)