Domain assignment for 2013563187 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
2 106 Cytidine deaminase-like 8.7e-37 Deoxycytidylate deaminase-like 0.00043 1uaq A: Alignments

Protein Sequence Details

Sequence length 116
Comment YNP6_483690 Cytosine/adenosine deaminases [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
MDEFMKAAIDEAKQGRQEGGIPIGSVLVKDGKIVGRGHNKRVQDNDPVTHAEIDCLRNARRIGNYQGTTLYSTLMPCYLCAGAVVQFGIKKVVAAESRTFPGAKDLWYLAASKSLI

Download

Sequence (FASTA)