Domain assignment for 2013561458 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
102 223 Thiolase-like 6.53e-42 Thiolase-related 0.00011 1qfl A:269-392 Alignments
3 101 Thiolase-like 0.000000000000059 Thiolase-related 0.0021 1qfl A:4-268 Alignments

Protein Sequence Details

Sequence length 224
Comment YNP6_466330 Acetyl-CoA acetyltransferase [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
GFAQQNGYFQRSLIPVKDQNGLLILEKDEYLRPNTTIEDLAKLPPAFAAIGELGFDTVAQLRYPQIERIHHLHTAGNSSGIVDGAALVLIGSAAKGRELGLKPRARIVSVAVTGSEPTIMLTGPSFATEKVLKKAGMRVADIDLWEMNEAFASAVLKFQRDFDIPTEKLNVNGGSIALGHPLGATGAIILGTVLDELERRDLNTALVTLCVGGGMGIATVIERV

Download

Sequence (FASTA)