Domain assignment for 2013561359 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
38 159 Thiolase-like 7.25e-43 Thiolase-related 0.00011 1afw A:294-417 Alignments
3 37 Thiolase-like 0.00000331 Thiolase-related 0.02 1wdk C:2-263 Alignments

Protein Sequence Details

Sequence length 160
Comment YNP6_465340 Acetyl-CoA acetyltransferase [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
RTAVPGGVITAGNASQFSDGAGACVVMNGKLSEQRGLKPLGIFRGFAVAGCEPDEMGIGPVFAVPKLLKRLGLKIEDIDLWELNEAFAVQVIYCADRLGIPYERLNVNGGAIALGHPYGMSGQRLVGHALIEGKRRGAKLVCVTMCIGGGMGAAGVFEVV

Download

Sequence (FASTA)