Domain assignment for 2013560983 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
94 224 DHS-like NAD/FAD-binding domain 3.85e-57 Pyruvate oxidase and decarboxylase, middle domain 0.0000493 1ybh A:281-459 Alignments
1 88 Thiamin diphosphate-binding fold (THDP-binding) 2.36e-22 Pyruvate oxidase and decarboxylase Pyr module 0.00023 1ybh A:86-280 Alignments

Protein Sequence Details

Sequence length 225
Comment YNP6_461570 acetolactate synthase, large subunit (EC 2.2.1.6) [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
VPMVVITGQVPRHLIGTDGFQETDIFGITLPIVKHSYVVRDPRQMSRIVAEAFHIAGTGRPGPVLIDIPKDVGLEEFDYQPVSEINIPGYKPTVRGNPRQIHTAAKLILQAKRPLLYVGGGAIISGAHAEIAELAHTYRIPVTTTLMGKGAFDENDPLSVGMLGMHGTAYANFAVTECDLLIAVGARFDDRVTGKLDEFAKHAKVIHIDIDPAEVGKNRAPDVPM

Download

Sequence (FASTA)