Domain assignment for 2013558497 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 109 Thiolase-like 3.26e-27 Thiolase-related 0.00077 1ulq A:3-275 Alignments

Protein Sequence Details

Sequence length 111
Comment YNP6_436590 Acetyl-CoA acetyltransferase [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
MQEAYIVAGYRTAVGKAGKGSFKNVRPDDLSVEVIRHLVSQVPGLTPALVDDVIVGCANPEGEQGLQIGRLIALRALGKEVPGMTINRYCASGLEAISIATAKIRAGMGHC

Download

Sequence (FASTA)