Domain assignment for 2013557005 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
90 210 Thiolase-like 6.29e-38 Thiolase-related 0.00025 1wdk C:264-391 Alignments
2 89 Thiolase-like 6.72e-21 Thiolase-related 0.00096 1qfl A:4-268 Alignments

Protein Sequence Details

Sequence length 214
Comment YNP6_421610 Acetyl-CoA acetyltransferase [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
LKSYEKAASATKAGKFRNEIIPITLPSKNGETLFNEDEDIFKVIPEKVTKLKPVFDEKGTITAANASNINDGAAAILLASKEAVEKYQLKPLAKIIAYADAAQAPEWFTTSPSVAITKALNQASLNFDDIDFFEINEAYAAVVLANQQLLGISDKKINLYGGAVAMGHPLGASGARVLCTLISVLHQESGKYGVAAICNGGGGATAMIIQNLYQ

Download

Sequence (FASTA)