Domain assignment for 2013556859 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
4 148 Cytidine deaminase-like 7.86e-44 Deoxycytidylate deaminase-like 0.0000395 2b3z A:1-145 Alignments

Protein Sequence Details

Sequence length 152
Comment YNP6_420130 diaminohydroxyphosphoribosylaminopyrimidine deaminase (EC 3.5.4.26)/5-amino-6-(5-phosphoribosylamino)uracil reductase (EC 1.1.1.193) [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
MHAHDFFMQRAVHLAALADGKVYPNPKVGAVLVHNNMIIGEGYHQYFGGAHAEVNAINSVAASNQNHIKDATLYCTLEPCCHTGKQPPCVHTIIKYNIKNIIIGNLDPNPLVAGKGVKMLRDAGCNVIENILPDACAQVNNRFLHFYQYNKP

Download

Sequence (FASTA)