Domain assignment for 2013556842 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
19 252 Thiolase-like 3.33e-54 Thiolase-related 0.0032 1j3n A:1-249 Alignments

Protein Sequence Details

Sequence length 254
Comment YNP6_419960 Polyketide synthase modules and related proteins [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
ISAFVEQDGEQKVTTRPSDIAIIGIGTLLPQAQYPETFWNNILRKVDAITEIPAQRWDWRLYYNPDRNARDKVYSKWGGFLEDVPFDPLRFGIPPKSLKSIEPVQLLALETVRRALEDAGYGSGNFDREHTSVILGAGGGIADLGQQYATRCEIPRMVGKTTPEVWDRLPEWTEESFPGLLLNVIAGRVANRFDFGGHNFTVDAACASSLAALDLAVKELESGRSNVAIAGGVDTVQSPFAYFCFSKTQLFTTR

Download

Sequence (FASTA)