Domain assignment for 2013556810 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
3 97 PLP-binding barrel 8.5e-33 "Hypothetical" protein ybl036c 0.00041 1ct5 A: Alignments

Protein Sequence Details

Sequence length 97
Comment YNP6_419640 Predicted enzyme with a TIM-barrel fold [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
MIEQNYYNVKNRLPSYVTLVVVSKTHPASAIQTLYDLCHRDFGENKVQELMNKYTLLPKDIRWHLIGHLQTNKVKYIVPFVHLIHSVDSEKLLTEIN

Download

Sequence (FASTA)