Domain assignment for 2013552536 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
2 118 Thiolase-like 8.52e-44 Thiolase-related 0.0000355 1ulq A:276-400 Alignments

Protein Sequence Details

Sequence length 120
Comment YNP6_376620 Acetyl-CoA acetyltransferase [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
MVTSAVVGVEPRTMGIGPVGATQKALQKAGLRPEEMDIIELNEAFAAQVLACTRLLGLADDDERLNPNGGAIALGHPLGMSGARLLLTAARELHHRRARYALCTMCIGVGQGYAVVLEKA

Download

Sequence (FASTA)