Domain assignment for 2013548642 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
2 83 Thiolase-like 2.17e-23 Thiolase-related 0.00028 1e5m A:256-416 Alignments

Protein Sequence Details

Sequence length 86
Comment YNP6_337580 3-oxoacyl-[acyl-carrier-protein] synthase II (EC 2.3.1.41) [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
NISSTKSMTGHLLGAAGAVEAVASVLAVKYDVVPPTINHFTDDPEIDKQFNLTFNHPQKRTVNAALSNGFGFGGHNATVIFKKFVQ

Download

Sequence (FASTA)