Domain assignment for 2013548051 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
11 150 Cytidine deaminase-like 5.07e-33 Deoxycytidylate deaminase-like 0.0043 1wwr A:1-151 Alignments

Protein Sequence Details

Sequence length 165
Comment YNP6_331610 Deoxycytidylate deaminase [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
MTKRKNYISWDEYFMGVALLSAKRRKDPDTQAGACIVNQKNKIVGAGYNGLPAGCDDDEFPWDKTGDFLQTKYPYVCHAELNAILNNIGMDLHGCRIYTALFPCNECAKAITQAGISEVIYLSDKYAGNDTAVASKRMLDTAGVSYRKVLPSISKIELSFYEGGV

Download

Sequence (FASTA)