Domain assignment for 2013545370 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
44 182 Thiolase-like 5.57e-33 Thiolase-related 0.00072 1wdk C:264-391 Alignments
2 42 Thiolase-like 0.0000000912 Thiolase-related 0.0043 1qfl A:4-268 Alignments

Protein Sequence Details

Sequence length 184
Comment YNP6_304670 Acetyl-CoA acetyltransferase [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
VSKLKPAFLKEGGTITAANASFLTDGAAVCLLMTEEKAQHLNMKPKAYIHSYTFTGCDLHDELLLGPTYAVSKLLHQTGLQLSDIDVFEFHEAFAGQILTNLKCLASDDFAKQKLGRDKAVGIIPMDKLNLWGGSLSLGHPFGATGARLVTTACNRLLKENGKYALIAACAAGAHGHAMILEKC

Download

Sequence (FASTA)