Domain assignment for 2013544323 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
4 146 Cytidine deaminase-like 3.51e-51 Deoxycytidylate deaminase-like 0.0000779 2b3j A:1-151 Alignments

Protein Sequence Details

Sequence length 147
Comment YNP6_294180 Cytosine/adenosine deaminases [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
MLEKRDEYFMRQALHLAEQAKQQGEIPVGAVVVCEDKIIGRGYNQTVALNDPTAHAEMLAITAATHAIGSRYLSECTLYVTLEPCVMCAGACYWAMLKKVVYGAGDEKNGFTKVGTSLFHPKTEVVSGLLEEEASKVLKDFFKKLRK

Download

Sequence (FASTA)