Domain assignment for 2013543872 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
2 96 Thiolase-like 2.7e-25 Thiolase-related 0.00018 1e5m A:256-416 Alignments

Protein Sequence Details

Sequence length 97
Comment YNP6_289640 3-oxoacyl-[acyl-carrier-protein] synthase II (EC 2.3.1.41) [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
YSTVFQENAYRLNISSTKSMTGHLLGAAGAIEAIATIMCVKDDIIPPTINHFTDDDQLDPKLNFTFHTAQKRTVRAALSNTFGFGGHNATVIFKKVD

Download

Sequence (FASTA)