Domain assignment for 2013543729 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 122 Thiamin diphosphate-binding fold (THDP-binding) 4.34e-33 Pyruvate oxidase and decarboxylase Pyr module 0.00045 1ozh A:7-187 Alignments
108 243 DHS-like NAD/FAD-binding domain 0.00000000000000705 Pyruvate oxidase and decarboxylase, middle domain 0.016 1ybh A:281-459 Alignments

Protein Sequence Details

Sequence length 264
Comment YNP6_288190 Thiamine pyrophosphate-requiring enzymes [acetolactate synthase, pyruvate dehydrogenase (cytochrome), glyoxylate carboligase, phosphonopyruvate decarboxylase] [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
RHEVNAVFAADAVSRLTGVPGVAVVTAGPGLTNTITAVKNAALAQSPLILLGGAAATILKGRGSLQDIDQLSIMRAVCKYSATISKVKEIVPALEKAIHIAQEGVPGPVFLECPIDTLYGEELVRSWYGAKSKDQKPRNIQERIVQWYINYHAKKLFDGKEDVRFDAPVQPPAFPIHNNSQLNKVVRMLQKAQKPLLLVGSGALMQAKRAGELAKAVEKLGIPVYLSGMGRGLLGKESPLQMRHHRKRPLRERPDILAEYPRFR

Download

Sequence (FASTA)