Domain assignment for 2013537511 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
48 169 Thiolase-like 1.06e-38 Thiolase-related 0.00021 1wdk C:264-391 Alignments
4 47 Thiolase-like 0.000000000399 Thiolase-related 0.005 1ulq A:3-275 Alignments

Protein Sequence Details

Sequence length 170
Comment YNP6_225720 Acetyl-CoA acetyltransferase [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
VKFDKIPLLRPVFIKDGTVTAANASTMNDGASALILASGEKCKELGLKPLAKILSYADAEQAPEWFTTSPSIAIPKALAKAGLKLEDVDFFEINEAFAVVSIVNNEKLNLDPKKVNVYGGAVSLGHPLGSSGSRIVATLLNVLIHNNGKYGAAGICNGGGGASSVVIERC

Download

Sequence (FASTA)