Domain assignment for 2013536989 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
3 248 YebC-like 9.03e-87 YebC-like 0.000000735 1kon A: Alignments

Protein Sequence Details

Sequence length 252
Comment YNP6_220480 conserved hypothetical protein TIGR01033 [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
MSGHSKWHTIRRTKGVNDQRRGQLFTKLARDITIATREGGSGDPDLNFRLRLAIEKARANNMPNENIQRAIDRGLGKSNEAALEEIFYEGYGPGGVAILIEAATDNRNRTSSDIRATFNKNGGSPGEPGSVAWMFEQKGLVTIDLSATKRDPDELQLMAIDAGADDVVVDDETLEVYCDWTQLNAVRQAFLDQGVPVSNAEKIMRAKTLIQPDEKDALAALRLIEKLEDLDDVQKVYSNLDITAELVARFDS

Download

Sequence (FASTA)