Domain assignment for 2013536868 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
4 63 Cytidine deaminase-like 2.58e-16 Deoxycytidylate deaminase-like 0.0019 2b3z A:1-145 Alignments

Protein Sequence Details

Sequence length 71
Comment YNP6_219270 diaminohydroxyphosphoribosylaminopyrimidine deaminase (EC 3.5.4.26)/5-amino-6-(5-phosphoribosylamino)uracil reductase (EC 1.1.1.193) [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
MENDEKYLRRCFELARLGAGWVSPNPMVGAILAYGDRIIGEGWHRRYGEAHAEVNAIGGVAVGERHLIRQS

Download

Sequence (FASTA)