Domain assignment for 2013536404 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 104 Thiolase-like 3.06e-36 Thiolase-related 0.0003 1afw A:294-417 Alignments

Protein Sequence Details

Sequence length 105
Comment YNP6_214550 Acetyl-CoA acetyltransferase [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
MGIGPVFAVSKLLKRHGLHVEDIYLWELNEAFAVQVVYCRDRLGIPDDRLNVNGGAIALGHPYGMSGTRLVGHALIEGRRRGARRVVVTMCIGGGMGASGLFEVF

Download

Sequence (FASTA)