Domain assignment for 2013532630 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 178 Thiolase-like 3.2e-52 Thiolase-related 0.0000289 1qfl A:4-268 Alignments
179 300 Thiolase-like 1.61e-38 Thiolase-related 0.00015 1wdk C:264-391 Alignments

Protein Sequence Details

Sequence length 301
Comment YNP6_176690 acetyl-CoA acetyltransferases [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
MKAITLGAQSIMLGINDIVVAGGMENMSQVPYYVPNARWGYKYGHGELIDGLAKDGLTDVYHQKAMGVCADATAAKYGISRKEQDAFAVDSYKRAAAAAEAGFFKEEIVPVAVPQRKGDPLLITEDEEYKKVSFDKIPTLRPAFTPDGTVTAANASTINDGASALVLASEKAVQMHGLKPIARIRGFADAEQEPEWFTTAPTLAAPKAMKMAGVEKTDIDFFEVNEAFAVVALAFEQLLDIAHEKTNVFGGAVSIGHPLGASGARIVTTLNNVLQQKDGTLGLAAICNGGGGATAIVIERL

Download

Sequence (FASTA)