Domain assignment for 2013532629 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
3 41 Thiolase-like 0.0000000749 Thiolase-related 0.0092 1ulq A:3-275 Alignments

Protein Sequence Details

Sequence length 56
Comment YNP6_176680 acetyl-CoA acetyltransferase (EC 2.3.1.9) [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
MKEVFIISAVRTPIGSFGGSLAGVSATHLGAAAIRELWKRPECTLMGDEVLWETSL

Download

Sequence (FASTA)