Domain assignment for 2013532171 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
3 76 Thiolase-like 2.05e-20 Thiolase-related 0.002 1qfl A:4-268 Alignments

Protein Sequence Details

Sequence length 99
Comment YNP6_172090 acetyl-CoA acetyltransferase (EC 2.3.1.9) [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
MDDVVIVGAARTPIGRFNSAYSGMSAIDLGAAAIQAAVQRAGIEPDSVDECIMGCVVTAGLGQSPARQQHFALAFRTQSRFDREQSVWQRSQGRDDRTL

Download

Sequence (FASTA)