Domain assignment for 2013531916 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View

Protein Sequence Details

Sequence length 39
Comment YNP6_169530 Thiolase, N-terminal domain. [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
MGCVMQGGLGQAPARQAAKFAGLPIKSFVLQSIKFAPVV

Download

Sequence (FASTA)