Domain assignment for 2013531915 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
7 182 Thiolase-like 3.12e-50 Thiolase-related 0.0000622 1qfl A:4-268 Alignments
183 303 Thiolase-like 7.76e-37 Thiolase-related 0.00041 1wdk C:264-391 Alignments

Protein Sequence Details

Sequence length 305
Comment YNP6_169520 acetyl-CoA acetyltransferases [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
LRQWYESVAQAVQAIRLGDADVVVAGGMESMSNVPFYNHQTRWGNKYGNITLEDGIAKDGLLDVYHNYPMGNAAELCAKELNITREAQDAHAIESYKRSQNAWDAGLFDSEIAPVEILQRGGEVKIFSKDEEPWNVKFEKIPTLKPVFVKDGTVTAANASTMNDGASALVLMSKEKMEELGIKPLAKVLSYADAEQAPEWFTTSPSLVIPIALQKAGLSINQIDFFEINEAFSVVSIANMQKLNISADKVNVFGGAVSLGHPLGSSGARILVTLLNVLEKKNGKYGVAGICNGGGGGSSMVIEKC

Download

Sequence (FASTA)