Domain assignment for 2013531885 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
6 183 Thiolase-like 1.21e-43 Thiolase-related 0.00015 1ox0 A:252-409 Alignments

Protein Sequence Details

Sequence length 183
Comment YNP6_169220 3-oxoacyl-(acyl-carrier-protein) synthase [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
LTSVHVCAFDADRNGLNLGEAAAYVFLEKEKTIKERRIKPLATLSGYSNFNEALHPAAPNPEGEGAYQAMKKAMEHARLSPSDIGYINAHGTATVTNDESESNAMIRLFKQVPAFSSTKPFTGHTLAAAGAVEAIISILALQEKKAWSNLNFKNPMPHSKLIPIQYNTTIHLLNHAMSNSFAF

Download

Sequence (FASTA)