Domain assignment for 2013531822 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
2 151 Cytidine deaminase-like 5.52e-48 Deoxycytidylate deaminase-like 0.0000206 1wkq A: Alignments

Protein Sequence Details

Sequence length 157
Comment YNP6_168590 Cytosine/adenosine deaminases [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
MDEHEKFLLEAIRVARQGMNQNSGGPFGCVIVKDGKIIASGCNMVTSMSDPTAHAEMVAIRKACLHLNSYQLSGCTLYASCEPCPMCMGAIYWSRPDRVFFAASRHDAANAGFDDAFIYEEMNVLPLNRKFPFVQISLQEASDLFKDWISKSDKMMY

Download

Sequence (FASTA)