Domain assignment for 2013530021 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
153 337 Thiamin diphosphate-binding fold (THDP-binding) 5.36e-62 Pyruvate oxidase and decarboxylase PP module 0.0000969 1ozh A:367-558 Alignments
1 160 DHS-like NAD/FAD-binding domain 9.82e-34 Pyruvate oxidase and decarboxylase, middle domain 0.0029 1ozh A:188-366 Alignments

Protein Sequence Details

Sequence length 343
Comment YNP6_150580 acetolactate synthase, large subunit (EC 2.2.1.6) [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
VGNGAIRSRASQAVTDFATRLQIPVVNTFMGKGVIPYTHPLALWTFGLQLRDFINCAFEETDLVLAVGYDHIEYSPKKWNPDGTIPIIHISETPAEVDSSYIPKLELVGDISDTLAEIMRRCDRTGKPMPKAVSLRPDIVADYEQYAHDQSFPIKPQKVIYDLRQVLAPEDVVISDVGAHKLWMARHFHCDRPNTCIISNGFAAMGIAIPGAVSAKLVLPNQVVVAVTGDGGFMMNMQELETATRLGTPFVTIIFNDGGYGLIEWKQQMQYGHSAYVKFGNPDFVKLAESMGLIGYRVQSCADLIPILKQAIQQKVPAVIDVPVDYRENMAFSRKQGEVSCPV

Download

Sequence (FASTA)