Domain assignment for 2013529254 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
202 334 FabD/lysophospholipase-like 6.02e-44 FabD-like 0.00022 1mla A:3-127,A:198-307 Alignments
5 101 Thiolase-like 3.7e-29 Thiolase-related 0.0034 1j3n A:250-408 Alignments
333 373 Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0000366 Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.01 1mla A:128-197 Alignments

Protein Sequence Details

Sequence length 373
Comment YNP6_142900 Polyketide synthase modules and related proteins [Hot spring microbial community from Yellowstone Hot Springs, sample from White Creek Site 3]
Sequence
VFRASTDKKGFCAVGSVKTNIGHSDITAGVAGLIKTVLALKHKQIPPSLHFQQPNPEIDFDNSPFYVNTTLSDWQTNGIPRRAGVSSFGIGGTNAHVILEEAPVVETRGGASLQSRPWHLLLLSAKTRTALETATVNLAAYLQQHRDLNLADVAYTLQVGRQAFEHRFMVVCQNLEDAVQKLEFANQEQVSTYLKELHNRPVVFMFPGQGAQYVNMGRELYQTEPIFREEVNRCCELLKPHLGIDLRHVLYPSEEQIEAATHQLQQTYITQPALFVIEYALSQLWMAWGIQPEAMIGHSIGEYVAACLAGVLSLEDALILVAVRGRLMQELPTGAMLSVHLAEDDLQPWLGKEVSLAASNAPNLCVVSGSEEA

Download

Sequence (FASTA)